Ty1
An alpaca-derived SARS-CoV-2 RBD-specific nanobody.
General information
Ty1 is an alpaca-derived single domain antibody, which strongly binds to the SARS-CoV-2 spike protein RBD (Hanke et al., 2020).
MAQVQLVETGGGLVQPGGSLRLSCAASGFTFSSVYMNWVRQAPGKGPEWVSRISPNSGN
IGYTDSVKGRFTISRDNAKNTLYLQMNNLKPEDTALYYCAIGLNLSSSSVRGQGTQVTVSS
Supporting references
| Link | Tested on | Impact factor | Notes | Publication date |
|---|---|---|---|---|
|
An alpaca nanobody neutralizes SARS-CoV-2 by blocking receptor interaction
Spike protein In vitro Antibody |
HEK293T cells expressing ACE2; Vero E6 cells | 12.12 | The alpaca-derived single domain antibody strongly binds to the SARS-CoV-2 spike protein RBD, thus inhibiting its interaction with the human ACE2. Ty1 neutralizes SARS-CoV-2 pseudotyped viruses and protects cells from infection in vitro. |
Sep/04/2020 |
|
Picomolar SARS-CoV-2 Neutralization Using Multi-Arm PEG Nanobody Constructs
In vitro |
Vero E6 cells | 4.08 | Using sortase and click chemistry, bi- and tetravalent constructs of Ty1 nanobodies were prepared. The increased valency enhanced SARS-CoV-2 neutralization in vitro with 4-arm PEG Ty1 tetramer having IC50 in the low picomolar range in Vero E6 cells. |
Dec/11/2020 |