P9
A peptide-mimetic SARS-CoV-2 Spike inhibitor.
General information
P9 is a peptide-mimetic of the N-terminal helix of human ACE2 receptor. It strongly binds to SARS-CoV-2 Spike protein RBD and inhibits SARS-CoV-2 infection in vitro (Karoyan et al., 2021).
SALEEQYKTFLDKFMHELEDLLYQLSL-NH2
Supporting references
| Link | Tested on | Impact factor | Notes | Publication date |
|---|---|---|---|---|
|
Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection
Spike protein ACE2 Peptide In vitro |
Vero E6 cells; Calu-3 cells; SARS-CoV-2 clinical isolate PSL2020 | Inhibited SARS-CoV-2 infection in Calu-3 cells with an IC50 of ca. 53 nM and an SI of ≥150. It displayed efficacy in Vero E6 cells, as well. |
Feb/12/2021 |