Other substances

P8

A peptide-mimetic SARS-CoV-2 Spike inhibitor.

Phase of research

Potential treatment - pre-clinical evidence

How it helps

Antiviral

Drug status

Experimental

1
 Supporting references
0
 Contradictory references
2
 AI-suggested references
2
 Clinical trials

General information

P8 is a peptide-mimetic of the N-terminal helix of human ACE2 receptor. It strongly binds to SARS-CoV-2 Spike protein RBD and inhibits SARS-CoV-2 infection in vitro (Karoyan et al., 2021).

 

SALEEQLKTFLDKFMHELEDLLYQLAL-NH2

Supporting references

Link Tested on Impact factor Notes Publication date
Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection
Spike protein ACE2 Peptide In vitro 		Vero E6 cells; Calu-3 cells; SARS-CoV-2 clinical isolate PSL2020

Inhibited SARS-CoV-2 infection in Calu-3 cells with an IC50 of ca. 46 nM and an SI of ≥150. It displayed efficacy in Vero E6 cells, as well.

 Feb/12/2021

AI-suggested references

Link Publication date
Design and Structure-Activity Relationship of a Potent Furin Inhibitor Derived from Influenza Hemagglutinin.
Feb/05/2021
Phage-Displayed Mimotopes of SARS-CoV-2 Spike Protein Targeted to Authentic and Alternative Cellular Receptors
Apr/01/2021

Clinical trials

ID Title Status Phase Start date Completion date
NCT04887233 Efficacy and Safety of Longan Extract Spray (P80 Spray) in Volunteers With Coronavirus Disease 2019 (COVID-19) Not yet recruiting Not Applicable Jul/01/2021 Jun/30/2022
  • Alternative id - 214/64
  • Interventions - Other: Longan nasal spray|Other: Placebo
  • Study type - Interventional
  • Study results - No Results Available
  • Locations -
  • Study designs - Allocation: Randomized|Intervention Model: Single Group Assignment|Masking: Double (Participant, Care Provider)|Primary Purpose: Supportive Care
  • Enrollment - 60
  • Age - 18 Years to 60 Years   (Adult)
  • Outcome measures - Nasal swab test negative|Absent of respiratory symptoms|No adverse event
NCT03830320 Positron Emission Tomography (PET) Imaging of Thrombosis Recruiting Phase 1 Aug/01/2016 May/31/2023
  • Alternative id - 2015P002385
  • Interventions - Drug: [64Cu]FBP8|Device: PET/MR|Procedure: Blood Collection|Procedure: Electrocardiogram
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - Massachusetts General Hospital, Boston, Massachusetts, United States
  • Study designs - Allocation: Non-Randomized|Intervention Model: Single Group Assignment|Masking: None (Open Label)|Primary Purpose: Diagnostic
  • Enrollment - 240
  • Age - 18 Years to 85 Years   (Adult, Older Adult)
  • Outcome measures - Complete blood count|Target to Background Ratio LAA|Target to Background Ratio|Time activity curve
Export (.csv)