P8
A peptide-mimetic SARS-CoV-2 Spike inhibitor.
General information
P8 is a peptide-mimetic of the N-terminal helix of human ACE2 receptor. It strongly binds to SARS-CoV-2 Spike protein RBD and inhibits SARS-CoV-2 infection in vitro (Karoyan et al., 2021).
SALEEQLKTFLDKFMHELEDLLYQLAL-NH2
Supporting references
| Link | Tested on | Impact factor | Notes | Publication date |
|---|---|---|---|---|
|
Human ACE2 peptide-mimics block SARS-CoV-2 pulmonary cells infection
Spike protein ACE2 Peptide In vitro |
Vero E6 cells; Calu-3 cells; SARS-CoV-2 clinical isolate PSL2020 | Inhibited SARS-CoV-2 infection in Calu-3 cells with an IC50 of ca. 46 nM and an SI of ≥150. It displayed efficacy in Vero E6 cells, as well. |
Feb/12/2021 |
AI-suggested references
Clinical trials
| ID | Title | Status | Phase | Start date | Completion date |
|---|---|---|---|---|---|
| NCT04887233 | Efficacy and Safety of Longan Extract Spray (P80 Spray) in Volunteers With Coronavirus Disease 2019 (COVID-19) | Not yet recruiting | Not Applicable | Jul/01/2021 | Jun/30/2022 |
|
|||||
| NCT03830320 | Positron Emission Tomography (PET) Imaging of Thrombosis | Recruiting | Phase 1 | Aug/01/2016 | May/31/2023 |
|
|||||