Other substances

Interferon beta-1b

A human cytokine.

Phase of research

Potential treatment - clinical evidence

How it helps

Antiviral

Drug status

Used to treat other disease

3
 Supporting references
0
 Contradictory references
7
 AI-suggested references
6
 Clinical trials

General information

Interferon beta-1b elevates the expression of MHC I proteins and induces the synthesis of several antiviral mediators. It acts through specific receptors and Janus kinase protein tyrosine kinases. Interferon beta-1b is used for treatment of relapsing/remitting multiple sclerosis (DrugBank).

Interferon beta-1b on Wikipedia

Synonyms

IFNβ-1b

Marketed as

BETAFERON; EXTAVIA; ZIFERON

 

SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNET
IVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Supporting references

Link Tested on Impact factor Notes Publication date
Triple combination of interferon beta-1b, lopinavir–ritonavir, and ribavirin in the treatment of patients admitted to hospital with COVID-19: an open-label, randomised, phase 2 trial
Patients

Combination of lopinavir 400 mg and ritonavir 100 mg every 12 h, ribavirin 400 mg every 12 h, and three doses of 8 million international units of interferon beta-1b on alternate days is better than lopinavir-ritonavir in alleviating symptoms and shortening the duration of viral shedding and hospital stay in patients with mild to moderate COVID-19

 May/08/2020
Interferon β-1b in treatment of severe COVID-19: A randomized clinical trial
Protein factor Randomized controlled open trial 		Patients 3.94

Significantly shortened time to clinical improvement, increased discharge rate at day 14, and reduced ICU admission rate. Discrease (not statistically significant) in overall 28-day mortality without serious side effects. Sample size: 33 + 33 control. Dosage: 250 μg subcutaneously every other day for two consecutive weeks.


 Aug/24/2020
Antiviral Activity of Type I, II, and III Interferons Counterbalances ACE2 Inducibility and Restricts SARS-CoV-2
Protein factor In vitro 		Calu-3 cells; primary human bronchial epithelial cells 6.78

Despite capability of ACE2 upregulation, the interferon inhibited SARS-CoV-2 in a dose-dependent manner and displayed potent antiviral activity in primary human bronchial epithelial cells.

 Sep/10/2020

AI-suggested references

Link Publication date
Interferon Beta-1b and Lopinavir-Ritonavir for Middle East Respiratory Syndrome.
Feb/23/2022
Comparing the outcomes of treatment with INF-beta 1-a (interferon beta-1a) and IFN-beta 1-b (interferon beta-1b) among COVID-19 inpatients
Mar/30/2022
Combination of (interferon beta-1b, lopinavir/ritonavir and ribavirin) versus favipiravir in hospitalized patients with non-critical COVID-19: A cohort study.
Jun/10/2021
Interferon beta-1b in treatment of severe COVID-19: A randomized clinical trial.
Aug/24/2020
Triple combination of interferon beta-1b, lopinavir-ritonavir, and ribavirin in the treatment of patients admitted to hospital with COVID-19: an open-label, randomised, phase 2 trial
May/10/2020
SARS-CoV-2 pharmacologic therapies and their safety/effectiveness according to level of evidence.
Sep/01/2020
Broad-Spectrum Host-Based Antivirals Targeting the Interferon and Lipogenesis Pathways as Potential Treatment Options for the Pandemic Coronavirus Disease 2019 (COVID-19)
Jun/10/2020

Clinical trials

ID Title Status Phase Start date Completion date
NCT04494399 IFN Beta-1b and Ribavirin for Covid-19 Recruiting Phase 2 Jul/29/2020 Aug/01/2022
  • Alternative id - UW 20-513
  • Interventions - Drug: Interferon beta-1b|Drug: Ribavirin
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - The University of Hong Kong, Queen Mary Hospital, Hong Kong, Hong Kong
  • Study designs - Allocation: Randomized|Intervention Model: Parallel Assignment|Masking: None (Open Label)|Primary Purpose: Treatment
  • Enrollment - 96
  • Age - 18 Years and older   (Adult, Older Adult)
  • Outcome measures - Clinical symptoms alleviation|Hospitalisation|Time to negative viral load|Inflammatory changes|Mortality|Adverse events and serious adverse events
NCT04465695 Dual Therapy With Interferon Beta-1b and Clofazimine for COVID-19 Recruiting Phase 2 Jul/14/2020 Sep/30/2021
  • Alternative id - UW 20-463
  • Interventions - Drug: Interferon beta-1b|Drug: Clofazimine
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - The University of Hong Kong, Queen Mary Hospital, Hong Kong, Hong Kong, China
  • Study designs - Allocation: Randomized|Intervention Model: Parallel Assignment|Masking: None (Open Label)|Primary Purpose: Treatment
  • Enrollment - 81
  • Age - 18 Years and older   (Adult, Older Adult)
  • Outcome measures - Clinical alleviation of symptoms|Hospitalisation|Time to negative viral load|Inflammatory changes|Mortality|Adverse events
NCT04647695 IFN-beta 1b and Remdesivir for COVID19 Recruiting Phase 2 Nov/20/2020 Sep/30/2021
  • Alternative id - UW 20-535
  • Interventions - Drug: Interferon beta-1b|Drug: Remdesivir
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - Queen Mary Hospital, Hong Kong, Hong Kong
  • Study designs - Allocation: Randomized|Intervention Model: Parallel Assignment|Masking: None (Open Label)|Primary Purpose: Treatment
  • Enrollment - 100
  • Age - 18 Years and older   (Adult, Older Adult)
  • Outcome measures - Clinical improvement|Hospitalisation|NPS viral load|TS viral load|Inflammatory markers|Adverse events|Mortality
NCT04276688 Lopinavir/ Ritonavir, Ribavirin and IFN-beta Combination for nCoV Treatment Completed Phase 2 Feb/10/2020 Mar/31/2020
  • Alternative id - UW-20-074
  • Interventions - Drug: Lopinavir/ritonavir|Drug: Ribavirin|Drug: Interferon Beta-1B
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - University of Hong Kong, Queen Mary Hospital, Hong Kong, Hong Kong
  • Study designs - Allocation: Randomized|Intervention Model: Parallel Assignment|Masking: None (Open Label)|Primary Purpose: Treatment
  • Enrollment - 127
  • Age - 18 Years and older   (Adult, Older Adult)
  • Outcome measures - Time to negative NPS|Time to negative saliva|Time to clinical improvement|Hospitalisation|Mortality|Immune reaction|Adverse events|Time to negative all clinical specimens
NCT04350281 Double Therapy With IFN-beta 1b and Hydroxychloroquine Completed Phase 2 Apr/09/2020 Jul/07/2020
  • Alternative id - UW 20-211
  • Interventions - Drug: Interferon Beta-1B|Drug: Hydroxychloroquine
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - The University of Hong Kong, Queen Mary Hospital, Hong Kong, Hong Kong
  • Study designs - Allocation: Randomized|Intervention Model: Parallel Assignment|Masking: None (Open Label)|Primary Purpose: Treatment
  • Enrollment - 60
  • Age - 18 Years and older   (Adult, Older Adult)
  • Outcome measures - Time to negative NPS viral load|Time to NEWS 0|Length of Hospitalisation|Time to negative viral load in all clinical samples|Adverse events|Mortality|Inflammatory markers changes
NCT04343768 An Investigation Into Beneficial Effects of Interferon Beta 1a, Compared to Interferon Beta 1b And The Base Therapeutic Regiment in Moderate to Severe COVID-19: A Randomized Clinical Trial Completed Phase 2 Apr/09/2020 Apr/27/2020
  • Alternative id - Different Interferons in COVID
  • Interventions - Drug: Hydroxychloroquine|Drug: Lopinavir / Ritonavir|Drug: Interferon Beta-1A|Drug: Interferon Beta-1B
  • Study type - Interventional
  • Study results - No Results Available
  • Locations - Loghman Hakim Hospital, Shahid Beheshti University of Medical Sciences and Health Services, Tehran, Iran, Islamic Republic of
  • Study designs - Allocation: Randomized|Intervention Model: Parallel Assignment|Masking: None (Open Label)|Primary Purpose: Treatment
  • Enrollment - 60
  • Age - 18 Years and older   (Adult, Older Adult)
  • Outcome measures - Time to clinical improvement|Mortality|SpO2 Improvement|Incidence of new mechanical ventilation use|Duration of hospitalization
Export (.csv)