Interferon beta-1b
A human cytokine.
General information
Interferon beta-1b elevates the expression of MHC I proteins and induces the synthesis of several antiviral mediators. It acts through specific receptors and Janus kinase protein tyrosine kinases. Interferon beta-1b is used for treatment of relapsing/remitting multiple sclerosis (DrugBank).
Interferon beta-1b on Wikipedia
Synonyms
IFNβ-1b
Marketed as
BETAFERON; EXTAVIA; ZIFERON
SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNET
IVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Supporting references
| Link | Tested on | Impact factor | Notes | Publication date |
|---|---|---|---|---|
|
Triple combination of interferon beta-1b, lopinavir–ritonavir, and ribavirin in the treatment of patients admitted to hospital with COVID-19: an open-label, randomised, phase 2 trial
|
Patients | Combination of lopinavir 400 mg and ritonavir 100 mg every 12 h, ribavirin 400 mg every 12 h, and three doses of 8 million international units of interferon beta-1b on alternate days is better than lopinavir-ritonavir in alleviating symptoms and shortening the duration of viral shedding and hospital stay in patients with mild to moderate COVID-19 |
May/08/2020 | |
|
Interferon β-1b in treatment of severe COVID-19: A randomized clinical trial
Protein factor Randomized controlled open trial |
Patients | 3.94 | Significantly shortened time to clinical improvement, increased discharge rate at day 14, and reduced ICU admission rate. Discrease (not statistically significant) in overall 28-day mortality without serious side effects. Sample size: 33 + 33 control. Dosage: 250 μg subcutaneously every other day for two consecutive weeks. |
Aug/24/2020 |
|
Antiviral Activity of Type I, II, and III Interferons Counterbalances ACE2 Inducibility and Restricts SARS-CoV-2
Protein factor In vitro |
Calu-3 cells; primary human bronchial epithelial cells | 6.78 | Despite capability of ACE2 upregulation, the interferon inhibited SARS-CoV-2 in a dose-dependent manner and displayed potent antiviral activity in primary human bronchial epithelial cells. |
Sep/10/2020 |
AI-suggested references
Clinical trials
| ID | Title | Status | Phase | Start date | Completion date |
|---|---|---|---|---|---|
| NCT04494399 | IFN Beta-1b and Ribavirin for Covid-19 | Recruiting | Phase 2 | Jul/29/2020 | Aug/01/2022 |
|
|||||
| NCT04465695 | Dual Therapy With Interferon Beta-1b and Clofazimine for COVID-19 | Recruiting | Phase 2 | Jul/14/2020 | Sep/30/2021 |
|
|||||
| NCT04647695 | IFN-beta 1b and Remdesivir for COVID19 | Recruiting | Phase 2 | Nov/20/2020 | Sep/30/2021 |
|
|||||
| NCT04276688 | Lopinavir/ Ritonavir, Ribavirin and IFN-beta Combination for nCoV Treatment | Completed | Phase 2 | Feb/10/2020 | Mar/31/2020 |
|
|||||
| NCT04350281 | Double Therapy With IFN-beta 1b and Hydroxychloroquine | Completed | Phase 2 | Apr/09/2020 | Jul/07/2020 |
|
|||||
| NCT04343768 | An Investigation Into Beneficial Effects of Interferon Beta 1a, Compared to Interferon Beta 1b And The Base Therapeutic Regiment in Moderate to Severe COVID-19: A Randomized Clinical Trial | Completed | Phase 2 | Apr/09/2020 | Apr/27/2020 |
|
|||||