EK1C4
An anti-coronaviral membrane fusion lipopeptide inhibitor.
General information
EK1C4 is EK1-derived lipopeptide that has enhanced activity blocking SARS-CoV-2-host membrane fusion (Xia et al., 2020).
Synonyms
EK-1-C4
SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL-GSGSG-PEG4-Chol
Supporting references
| Link | Tested on | Impact factor | Notes | Publication date |
|---|---|---|---|---|
|
SARS-CoV-2 variants B.1.351 and P.1 escape from neutralizing antibodies
Spike protein RNA Small molecule Peptide In vitro Antibody Mixed substance |
Caco-2 cells; Vero cells; Sera of vaccinated individuals; (VSV) SARS-CoV-2 Spike-pseudotyped virus (WT, B.1.1.7, B.1.351, ant P.1 variants) | 38.64 | EK-1-C4 displayed in vitro inhibition of SARS-CoV-2 Spike-pseudotyped virus infection for all tested emergent Spike variants (B.1.1.7, B.1.351, and P.1). It was especially potent against the P.1 variant. |
Mar/20/2021 |
|
Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion
Spike protein Biophysical assay Peptide In vitro |
in vitro binding assay; in vitro biophysical assay; 293T/ACE2 cells; Huh-7 cells; Vero E6 cells; mice; SARS-CoV-2 Spike pseudovirus; SARS-CoV-2 live virus | 20.51 | Inhibited SARS-CoV-2 Spike pseudovirus and live virus infection with IC50s of 15.8 nM and 36.5 nM, respectively, in vitro. The lipopeptide acts as a SARS-CoV-2-host Spike protein-mediated membrane fusion inhibitor (with an IC50 of 1.3 nM). It also displayed anti-HCoV-OC43 (a common coronavirus) activity in a mouse model. |
Mar/30/2020 |