Other substances

EK1

An anti-coronaviral membrane fusion peptide inhibitor.

Phase of research

Potential treatment - pre-clinical evidence

How it helps

Antiviral

Drug status

Experimental

Supporting references

Contradictory references

AI-suggested references

Clinical trials

General information

EK1 is a pan-coronavirus membrane fusion inhibitory peptide. It targets Spike protein heptad repeat 1 domain (Xia et al., 2019). It has been shown to inhibit SARS-CoV-2 infection in vitro (Xia et al., 2020a; Xia et al., 2020b).

Synonyms

EK-1

SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL

Supporting references

Link	Tested on	Impact factor	Notes	Publication date
SARS-CoV-2 variants B.1.351 and P.1 escape from neutralizing antibodies Spike protein RNA Small molecule Peptide In vitro Antibody Mixed substance	Caco-2 cells; Vero cells; Sera of vaccinated individuals; (VSV) SARS-CoV-2 Spike-pseudotyped virus (WT, B.1.1.7, B.1.351, ant P.1 variants)	38.64	EK-1 displayed in vitro inhibition of SARS-CoV-2 Spike-pseudotyped virus infection for all tested emergent Spike variants (B.1.1.7, B.1.351, and P.1). It was especially potent against the P.1 variant.	Mar/20/2021
Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein Spike protein Biophysical assay Peptide In vitro	in vitro binding assay; in vitro biophysical assay; 293T-hACE2 cells; SARS-CoV-2 Spike pseudovirus	8.48	Inhibited SARS-CoV-2 Spike pseudovirus infection with an IC50 of 0.19 μM.	Feb/11/2020

AI-suggested references

Link	Publication date
Drug treatment options for the 2019-new coronavirus (2019-nCoV).	Dec/16/2021
Repurposing fusion inhibitor peptide against SARS-CoV-2.	Feb/04/2021
A bivalent protein targeting glycans and HR1 domain in spike protein potently inhibited infection of SARS-CoV-2 and other human coronaviruses.	Jul/08/2021
Drug screening and development from the affinity of S protein of new coronavirus with ACE2.	Oct/09/2020
A robust high-throughput fluorescent polarization assay for the evaluation and screening of SARS-CoV-2 fusion inhibitors	May/28/2020
A Palmitic Acid-Conjugated, Peptide-Based pan-CoV Fusion Inhibitor Potently Inhibits Infection of SARS-CoV-2 Omicron and Other Variants of Concern	Mar/06/2022
25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses	Nov/01/2021
Pan-coronavirus fusion inhibitors possess potent inhibitory activity against HIV-1, HIV-2, and simian immunodeficiency virus	Apr/14/2021
Structural and functional basis for pan-CoV fusion inhibitors against SARS-CoV-2 and its variants with preclinical evaluation.	Jul/29/2021
A Modified Fibronectin Type III Domain-Conjugated, Long-Acting Pan-Coronavirus Fusion Inhibitor with Extended Half-Life	Jan/28/2022

Export (.csv)