EK1
An anti-coronaviral membrane fusion peptide inhibitor.
General information
EK1 is a pan-coronavirus membrane fusion inhibitory peptide. It targets Spike protein heptad repeat 1 domain (Xia et al., 2019). It has been shown to inhibit SARS-CoV-2 infection in vitro (Xia et al., 2020a; Xia et al., 2020b).
Synonyms
EK-1
SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL
Supporting references
| Link | Tested on | Impact factor | Notes | Publication date |
|---|---|---|---|---|
|
SARS-CoV-2 variants B.1.351 and P.1 escape from neutralizing antibodies
Spike protein RNA Small molecule Peptide In vitro Antibody Mixed substance |
Caco-2 cells; Vero cells; Sera of vaccinated individuals; (VSV) SARS-CoV-2 Spike-pseudotyped virus (WT, B.1.1.7, B.1.351, ant P.1 variants) | 38.64 | EK-1 displayed in vitro inhibition of SARS-CoV-2 Spike-pseudotyped virus infection for all tested emergent Spike variants (B.1.1.7, B.1.351, and P.1). It was especially potent against the P.1 variant. |
Mar/20/2021 |
|
Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein
Spike protein Biophysical assay Peptide In vitro |
in vitro binding assay; in vitro biophysical assay; 293T-hACE2 cells; SARS-CoV-2 Spike pseudovirus | 8.48 | Inhibited SARS-CoV-2 Spike pseudovirus infection with an IC50 of 0.19 μM. |
Feb/11/2020 |